SCOP 1.75: Domain d1tloa_: 1tlo A:

Lineage for d1tloa_ (1tlo A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)

6. Protein Calpain large subunit, catalytic domain (domain II) [54041] (5 species)
   includes the N-terminal 'sequence' domain I

7. Species Rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (10 PDB entries)
   Uniprot P97571 33-353

8. Domain d1tloa_: 1tlo A: [112508]
   complexed with ca, e64

Details for d1tloa_

PDB Entry: 1tlo, 1.9 Å

PDB Description: high resolution crystal structure of calpain i protease core in complex with e64

PDB Compounds: (A:) Calpain 1, large [catalytic] subunit

SCOP Domain Sequences for d1tloa_:

Sequence; same for both SEQRES and ATOM records:

>d1tloa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}
naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq
lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
efwmsfrdfireftkleicnlt

Timeline for d1tloa_:

• d1tloa_ first appeared in SCOP 1.71
  
• d1tloa_ appears in SCOP 1.73
  
• d1tloa_ appears in SCOPe 2.01
  
• d1tloa_ appears in the current release, SCOPe 2.08