Lineage for d1tl9a_ (1tl9 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534248Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
    automatically mapped to Pfam PF00648
  6. 2534249Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
    includes the N-terminal 'sequence' domain I
  7. 2534267Species Norway rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (10 PDB entries)
    Uniprot P97571 33-353
  8. 2534268Domain d1tl9a_: 1tl9 A: [112505]
    complexed with ca

Details for d1tl9a_

PDB Entry: 1tl9 (more details), 1.8 Å

PDB Description: High resolution crystal structure of calpain I protease core in complex with leupeptin
PDB Compounds: (A:) Calpain 1, large [catalytic] subunit

SCOPe Domain Sequences for d1tl9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tl9a_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), mu-type [TaxId: 10116]}
naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq
lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
efwmsfrdfireftkleicnl

SCOPe Domain Coordinates for d1tl9a_:

Click to download the PDB-style file with coordinates for d1tl9a_.
(The format of our PDB-style files is described here.)

Timeline for d1tl9a_: