SCOP 1.73: Domain d1tl9a_: 1tl9 A:

Lineage for d1tl9a_ (1tl9 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)

6. Protein Calpain large subunit, catalytic domain (domain II) [54041] (5 species)
   includes the N-terminal 'sequence' domain I

7. Species Rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (8 PDB entries)

8. Domain d1tl9a_: 1tl9 A: [112505]
   complexed with ace, ca

Details for d1tl9a_

PDB Entry: 1tl9, 1.8 Å

PDB Description: High resolution crystal structure of calpain I protease core in complex with leupeptin

PDB Compounds: (A:) Calpain 1, large [catalytic] subunit

SCOP Domain Sequences for d1tl9a_:

Sequence; same for both SEQRES and ATOM records:

>d1tl9a_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}
naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq
lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
efwmsfrdfireftkleicnl

Timeline for d1tl9a_:

• d1tl9a_ first appeared in SCOP 1.71
  
• d1tl9a_ appears in SCOP 1.75
  
• d1tl9a_ appears in the current release, SCOPe 2.08