SCOPe 2.01: Domain d1tl7c2: 1tl7 C:39-65,C:202-388

Lineage for d1tl7c2 (1tl7 C:39-65,C:202-388)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (15 PDB entries)
   Uniprot P04896 39-388

8. Domain d1tl7c2: 1tl7 C:39-65,C:202-388 [112504]
   Other proteins in same PDB: d1tl7a_, d1tl7b_, d1tl7c1
   complexed with cl, fok, gsp, mg, mn, onm

Details for d1tl7c2

PDB Entry: 1tl7, 2.8 Å

PDB Description: Complex Of Gs- With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'(3')-O-(N-methylanthraniloyl)-guanosine 5'-triphosphate and Mn

PDB Compounds: (C:) Guanine nucleotide-binding protein G(s), alpha subunit

SCOPe Domain Sequences for d1tl7c2:

Sequence; same for both SEQRES and ATOM records:

>d1tl7c2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrmhl

Timeline for d1tl7c2:

• d1tl7c2 first appeared in SCOP 1.71
  
• d1tl7c2 appears in SCOP 1.75
  
• d1tl7c2 appears in SCOPe 2.02
  
• d1tl7c2 appears in the current release, SCOPe 2.08