Lineage for d1tl7c1 (1tl7 C:86-201)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330344Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2330345Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2330346Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2330347Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2330348Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)
  8. 2330368Domain d1tl7c1: 1tl7 C:86-201 [112503]
    Other proteins in same PDB: d1tl7a_, d1tl7b_, d1tl7c2
    complexed with cl, fok, gsp, mg, mn, onm

Details for d1tl7c1

PDB Entry: 1tl7 (more details), 2.8 Å

PDB Description: Complex Of Gs- With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'(3')-O-(N-methylanthraniloyl)-guanosine 5'-triphosphate and Mn
PDB Compounds: (C:) Guanine nucleotide-binding protein G(s), alpha subunit

SCOPe Domain Sequences for d1tl7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tl7c1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

SCOPe Domain Coordinates for d1tl7c1:

Click to download the PDB-style file with coordinates for d1tl7c1.
(The format of our PDB-style files is described here.)

Timeline for d1tl7c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tl7c2