SCOPe 2.01: Domain d1tl7c1: 1tl7 C:86-201

Lineage for d1tl7c1 (1tl7 C:86-201)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (15 PDB entries)

8. Domain d1tl7c1: 1tl7 C:86-201 [112503]
   Other proteins in same PDB: d1tl7a_, d1tl7b_, d1tl7c2
   complexed with cl, fok, gsp, mg, mn, onm

Details for d1tl7c1

PDB Entry: 1tl7, 2.8 Å

PDB Description: Complex Of Gs- With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'(3')-O-(N-methylanthraniloyl)-guanosine 5'-triphosphate and Mn

PDB Compounds: (C:) Guanine nucleotide-binding protein G(s), alpha subunit

SCOPe Domain Sequences for d1tl7c1:

Sequence; same for both SEQRES and ATOM records:

>d1tl7c1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

Timeline for d1tl7c1:

• d1tl7c1 first appeared in SCOP 1.71
  
• d1tl7c1 appears in SCOP 1.75
  
• d1tl7c1 appears in SCOPe 2.02
  
• d1tl7c1 appears in the current release, SCOPe 2.08