SCOP 1.75: Domain d1tl7b_: 1tl7 B:

Lineage for d1tl7b_ (1tl7 B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Type II adenylyl cyclase C2 domain [55075] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [55076] (5 PDB entries)
   Uniprot P26769 879-1077

8. Domain d1tl7b_: 1tl7 B: [112502]
   Other proteins in same PDB: d1tl7a_, d1tl7c1, d1tl7c2
   complexed with cl, fok, gsp, mg, mn, onm

Details for d1tl7b_

PDB Entry: 1tl7, 2.8 Å

PDB Description: Complex Of Gs- With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'(3')-O-(N-methylanthraniloyl)-guanosine 5'-triphosphate and Mn

PDB Compounds: (B:) adenylate cyclase, type II

SCOP Domain Sequences for d1tl7b_:

Sequence, based on SEQRES records:

>d1tl7b_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records):

>d1tl7b_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
dlktyfvnt

Timeline for d1tl7b_:

• d1tl7b_ first appeared in SCOP 1.71
  
• d1tl7b_ appears in SCOP 1.73
  
• d1tl7b_ appears in SCOPe 2.01
  
• d1tl7b_ appears in the current release, SCOPe 2.08