Lineage for d1tl7b_ (1tl7 B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604796Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 604797Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
    Pfam 00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 604840Protein Type II adenylyl cyclase C2 domain [55075] (1 species)
  7. 604841Species Rat (Rattus norvegicus) [TaxId:10116] [55076] (3 PDB entries)
  8. 604844Domain d1tl7b_: 1tl7 B: [112502]
    Other proteins in same PDB: d1tl7a_, d1tl7c1, d1tl7c2
    complexed with cl, fok, gsp, mg, mn, onm

Details for d1tl7b_

PDB Entry: 1tl7 (more details), 2.8 Å

PDB Description: Complex Of Gs- With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'(3')-O-(N-methylanthraniloyl)-guanosine 5'-triphosphate and Mn

SCOP Domain Sequences for d1tl7b_:

Sequence, based on SEQRES records: (download)

>d1tl7b_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Rat (Rattus norvegicus)}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d1tl7b_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Rat (Rattus norvegicus)}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
dlktyfvnt

SCOP Domain Coordinates for d1tl7b_:

Click to download the PDB-style file with coordinates for d1tl7b_.
(The format of our PDB-style files is described here.)

Timeline for d1tl7b_: