Lineage for d1tl5a_ (1tl5 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604479Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (1 family) (S)
  5. 604480Family d.58.17.1: HMA, heavy metal-associated domain [55009] (8 proteins)
  6. 604481Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 604487Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (5 PDB entries)
  8. 604495Domain d1tl5a_: 1tl5 A: [112500]

Details for d1tl5a_

PDB Entry: 1tl5 (more details)

PDB Description: solution structure of apohah1

SCOP Domain Sequences for d1tl5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tl5a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1}
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle

SCOP Domain Coordinates for d1tl5a_:

Click to download the PDB-style file with coordinates for d1tl5a_.
(The format of our PDB-style files is described here.)

Timeline for d1tl5a_: