![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
![]() | Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species) |
![]() | Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (16 PDB entries) Uniprot O00244 |
![]() | Domain d1tl4a_: 1tl4 A: [112499] complexed with cu1 |
PDB Entry: 1tl4 (more details)
SCOPe Domain Sequences for d1tl4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tl4a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk tvsylgle
Timeline for d1tl4a_: