| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) ![]() putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2) |
| Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein) |
| Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (2 species) |
| Species Escherichia coli [TaxId:562] [55189] (5 PDB entries) Uniprot P0A8M3 |
| Domain d1tkya2: 1tky A:63-224 [112489] Other proteins in same PDB: d1tkya1 protein/RNA complex; complexed with a3s |
PDB Entry: 1tky (more details), 1.48 Å
SCOPe Domain Sequences for d1tkya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tkya2 d.67.1.1 (A:63-224) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Escherichia coli [TaxId: 562]}
kdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedvealek
rmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvdmc
rgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawa
Timeline for d1tkya2: