Lineage for d1tkya1 (1tky A:1-62)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1196274Superfamily d.15.10: TGS-like [81271] (2 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 1196275Family d.15.10.1: TGS domain [81270] (1 protein)
  6. 1196276Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species)
  7. 1196277Species Escherichia coli [TaxId:562] [55177] (5 PDB entries)
    Uniprot P0A8M3
  8. 1196279Domain d1tkya1: 1tky A:1-62 [112488]
    Other proteins in same PDB: d1tkya2
    protein/RNA complex; complexed with a3s

Details for d1tkya1

PDB Entry: 1tky (more details), 1.48 Å

PDB Description: Crystal structure of the editing domain of threonyl-tRNA synthetase complexed with seryl-3'-aminoadenosine
PDB Compounds: (A:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1tkya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkya1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]}
mpvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsii
ta

SCOPe Domain Coordinates for d1tkya1:

Click to download the PDB-style file with coordinates for d1tkya1.
(The format of our PDB-style files is described here.)

Timeline for d1tkya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tkya2