SCOP 1.75: Domain d1tkpb_: 1tkp B:

Lineage for d1tkpb_ (1tkp B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (9 proteins)

6. Protein Dodecameric ferritin homolog [47250] (13 species)

7. Species Archaeon Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries)
   Uniprot Q9HMP7

8. Domain d1tkpb_: 1tkp B: [112479]

Details for d1tkpb_

PDB Entry: 1tkp, 2.2 Å

PDB Description: iron-oxo clusters biomineralizing on protein surfaces. structural analysis of h.salinarum dpsa in its low and high iron states

PDB Compounds: (B:) Iron-rich dpsA-homolog protein

SCOP Domain Sequences for d1tkpb_:

Sequence; same for both SEQRES and ATOM records:

>d1tkpb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Archaeon Halobacterium salinarum [TaxId: 2242]}
aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal

Timeline for d1tkpb_:

• d1tkpb_ first appeared in SCOP 1.71
  
• d1tkpb_ appears in SCOP 1.73
  
• d1tkpb_ appears in SCOPe 2.01
  
• d1tkpb_ appears in the current release, SCOPe 2.08