SCOP 1.71: Domain d1tkea2: 1tke A:63-224

Lineage for d1tkea2 (1tke A:63-224)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families)
   putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)

5. Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein)

6. Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (2 species)

7. Species Escherichia coli [TaxId:562] [55189] (5 PDB entries)

8. Domain d1tkea2: 1tke A:63-224 [112471]
   Other proteins in same PDB: d1tkea1
   complexed with ser

Details for d1tkea2

PDB Entry: 1tke, 1.46 Å

PDB Description: Crystal structure of the editing domain of threonyl-tRNA synthetase complexed with serine

SCOP Domain Sequences for d1tkea2:

Sequence; same for both SEQRES and ATOM records:

>d1tkea2 d.67.1.1 (A:63-224) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Escherichia coli}
kdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedvealek
rmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvdmc
rgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawa

Timeline for d1tkea2:

• d1tkea2 is new in SCOP 1.71
  
• d1tkea2 appears in SCOP 1.73
  
• d1tkea2 appears in the current release, SCOPe 2.08