![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.10: TGS-like [81271] (2 families) ![]() possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
![]() | Family d.15.10.1: TGS domain [81270] (1 protein) |
![]() | Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55177] (5 PDB entries) Uniprot P0A8M3 |
![]() | Domain d1tkea1: 1tke A:1-62 [112470] Other proteins in same PDB: d1tkea2 protein/RNA complex; complexed with ser |
PDB Entry: 1tke (more details), 1.46 Å
SCOPe Domain Sequences for d1tkea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} mpvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsii ta
Timeline for d1tkea1: