Lineage for d1tkea1 (1tke A:1-62)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 718256Superfamily d.15.10: TGS-like [81271] (2 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 718257Family d.15.10.1: TGS domain [81270] (1 protein)
  6. 718258Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species)
  7. 718259Species Escherichia coli [TaxId:562] [55177] (5 PDB entries)
  8. 718260Domain d1tkea1: 1tke A:1-62 [112470]
    Other proteins in same PDB: d1tkea2
    complexed with ser

Details for d1tkea1

PDB Entry: 1tke (more details), 1.46 Å

PDB Description: Crystal structure of the editing domain of threonyl-tRNA synthetase complexed with serine
PDB Compounds: (A:) threonyl-tRNA synthetase

SCOP Domain Sequences for d1tkea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]}
mpvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsii
ta

SCOP Domain Coordinates for d1tkea1:

Click to download the PDB-style file with coordinates for d1tkea1.
(The format of our PDB-style files is described here.)

Timeline for d1tkea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tkea2