Lineage for d1tk6d_ (1tk6 D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536010Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 536144Protein Dodecameric ferritin homolog [47250] (10 species)
  7. 536152Species Archaeon Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries)
  8. 536164Domain d1tk6d_: 1tk6 D: [112469]
    complexed with fe, mg, na, so4

Details for d1tk6d_

PDB Entry: 1tk6 (more details), 2.2 Å

PDB Description: iron-oxo clusters biomineralizing on protein surfaces. structural analysis of h.salinarum dpsa in its low and high iron states

SCOP Domain Sequences for d1tk6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tk6d_ a.25.1.1 (D:) Dodecameric ferritin homolog {Archaeon Halobacterium salinarum}
aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal

SCOP Domain Coordinates for d1tk6d_:

Click to download the PDB-style file with coordinates for d1tk6d_.
(The format of our PDB-style files is described here.)

Timeline for d1tk6d_: