Lineage for d1tk6c_ (1tk6 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701875Species Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries)
    Uniprot Q9HMP7
  8. 2701886Domain d1tk6c_: 1tk6 C: [112468]
    complexed with fe, mg, na, so4

Details for d1tk6c_

PDB Entry: 1tk6 (more details), 2.2 Å

PDB Description: iron-oxo clusters biomineralizing on protein surfaces. structural analysis of h.salinarum dpsa in its low and high iron states
PDB Compounds: (C:) Iron-rich dpsA-homolog protein

SCOPe Domain Sequences for d1tk6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tk6c_ a.25.1.1 (C:) Dodecameric ferritin homolog {Halobacterium salinarum [TaxId: 2242]}
aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal

SCOPe Domain Coordinates for d1tk6c_:

Click to download the PDB-style file with coordinates for d1tk6c_.
(The format of our PDB-style files is described here.)

Timeline for d1tk6c_: