![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (9 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (9 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (13 species) |
![]() | Species Archaeon Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries) Uniprot Q9HMP7 |
![]() | Domain d1tk6b_: 1tk6 B: [112467] |
PDB Entry: 1tk6 (more details), 2.2 Å
SCOP Domain Sequences for d1tk6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tk6b_ a.25.1.1 (B:) Dodecameric ferritin homolog {Archaeon Halobacterium salinarum [TaxId: 2242]} aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal
Timeline for d1tk6b_: