Class b: All beta proteins [48724] (165 folds) |
Fold b.7: C2 domain-like [49561] (4 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) two constituent families are related by circular permutation |
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins) topologically similar to the C-terminal domain of PapD |
Protein Synaptogamin I [49576] (1 species) duplication: contains tandem repeat of two similar domains |
Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (7 PDB entries) |
Domain d1tjxa_: 1tjx A: [112465] complexed with act, ca, gol |
PDB Entry: 1tjx (more details), 1.04 Å
SCOP Domain Sequences for d1tjxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjxa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns tgaelrhwsdmlanprrpiaqwhtlqveeevdamlav
Timeline for d1tjxa_: