Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Dodecameric ferritin homolog [47250] (13 species) |
Species Archaeon Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries) |
Domain d1tjod_: 1tjo D: [112464] complexed with fe, mg, na, so4 |
PDB Entry: 1tjo (more details), 1.6 Å
SCOP Domain Sequences for d1tjod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjod_ a.25.1.1 (D:) Dodecameric ferritin homolog {Archaeon Halobacterium salinarum [TaxId: 2242]} aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal
Timeline for d1tjod_: