SCOPe 2.07: Domain d1tjoc_: 1tjo C:

Lineage for d1tjoc_ (1tjo C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (16 species)

7. Species Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries)
   Uniprot Q9HMP7

8. Domain d1tjoc_: 1tjo C: [112463]
   complexed with fe, mg, na, so4

Details for d1tjoc_

PDB Entry: 1tjo, 1.6 Å

PDB Description: iron-oxo clusters biomineralizing on protein surfaces. structural analysis of h.salinarum dpsa in its low and high iron states

PDB Compounds: (C:) Iron-rich dpsA-homolog protein

SCOPe Domain Sequences for d1tjoc_:

Sequence; same for both SEQRES and ATOM records:

>d1tjoc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Halobacterium salinarum [TaxId: 2242]}
aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal

Timeline for d1tjoc_:

• d1tjoc_ first appeared in SCOP 1.71
  
• d1tjoc_ appears in SCOPe 2.06
  
• d1tjoc_ appears in the current release, SCOPe 2.08