Lineage for d1tjoc_ (1tjo C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766238Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 766246Species Archaeon Halobacterium salinarum [TaxId:2242] [101135] (5 PDB entries)
    Uniprot Q9HMP7
  8. 766249Domain d1tjoc_: 1tjo C: [112463]

Details for d1tjoc_

PDB Entry: 1tjo (more details), 1.6 Å

PDB Description: iron-oxo clusters biomineralizing on protein surfaces. structural analysis of h.salinarum dpsa in its low and high iron states
PDB Compounds: (C:) Iron-rich dpsA-homolog protein

SCOP Domain Sequences for d1tjoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjoc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Archaeon Halobacterium salinarum [TaxId: 2242]}
aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal

SCOP Domain Coordinates for d1tjoc_:

Click to download the PDB-style file with coordinates for d1tjoc_.
(The format of our PDB-style files is described here.)

Timeline for d1tjoc_: