Class b: All beta proteins [48724] (178 folds) |
Fold b.95: Ganglioside M2 (gm2) activator [63706] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.95.1: Ganglioside M2 (gm2) activator [63707] (1 family) |
Family b.95.1.1: Ganglioside M2 (gm2) activator [63708] (1 protein) |
Protein Ganglioside M2 (gm2) activator [63709] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [63710] (8 PDB entries) Uniprot P17900 31-193 |
Domain d1tjjb1: 1tjj B:3-164 [112459] Other proteins in same PDB: d1tjja2, d1tjjb2, d1tjjc2 complexed with act, cl, dao, epe, ipa, lpe, pfs |
PDB Entry: 1tjj (more details), 2 Å
SCOPe Domain Sequences for d1tjjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjjb1 b.95.1.1 (B:3-164) Ganglioside M2 (gm2) activator {Human (Homo sapiens) [TaxId: 9606]} ssfswdncdegkdpavirsltlepdpivvpgnvtlsvvgstsvplssplkvdlvlekeva glwikipctdyigsctfehfcdvldmliptgepcpeplrtyglpchcpfkegtyslpkse fvvpdlelpswlttgnyriesvlsssgkrlgcikiaaslkgi
Timeline for d1tjjb1:
View in 3D Domains from other chains: (mouse over for more information) d1tjja1, d1tjja2, d1tjjc1, d1tjjc2 |