SCOP 1.71: Domain d1tjhl1: 1tjh L:1-107

Lineage for d1tjhl1 (1tjh L:1-107)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (52 PDB entries)

8. Domain d1tjhl1: 1tjh L:1-107 [112452]
   Other proteins in same PDB: d1tjhh1, d1tjhh2, d1tjhl2
   complexed with ace, egl, ioh, nh2, ycm

Details for d1tjhl1

PDB Entry: 1tjh, 2.1 Å

PDB Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 11mer epitope

SCOP Domain Sequences for d1tjhl1:

Sequence; same for both SEQRES and ATOM records:

>d1tjhl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvr

Timeline for d1tjhl1:

• d1tjhl1 is new in SCOP 1.71
  
• d1tjhl1 appears in SCOP 1.73
  
• d1tjhl1 appears in the current release, SCOPe 2.07