Lineage for d1tjhh2 (1tjh H:114-216)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026995Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2027002Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2027044Domain d1tjhh2: 1tjh H:114-216 [112451]
    Other proteins in same PDB: d1tjhh1, d1tjhl1, d1tjhl2
    complexed with edo, ipa

Details for d1tjhh2

PDB Entry: 1tjh (more details), 2.1 Å

PDB Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 11mer epitope
PDB Compounds: (H:) anti-HIV-1 antibody 2F5 Heavy Chain

SCOPe Domain Sequences for d1tjhh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjhh2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tstkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d1tjhh2:

Click to download the PDB-style file with coordinates for d1tjhh2.
(The format of our PDB-style files is described here.)

Timeline for d1tjhh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tjhh1