SCOP 1.75: Domain d1tjhh2: 1tjh H:114-216

Lineage for d1tjhh2 (1tjh H:114-216)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
   SQ NA # humanized antibody
   Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
   SQ NA # engineered antibody
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1tjhh2: 1tjh H:114-216 [112451]
   Other proteins in same PDB: d1tjhh1, d1tjhl1, d1tjhl2
   complexed with ace, egl, ioh, nh2, ycm

Details for d1tjhh2

PDB Entry: 1tjh, 2.1 Å

PDB Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 11mer epitope

PDB Compounds: (H:) anti-HIV-1 antibody 2F5 Heavy Chain

SCOP Domain Sequences for d1tjhh2:

Sequence; same for both SEQRES and ATOM records:

>d1tjhh2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tstkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1tjhh2:

• d1tjhh2 first appeared in SCOP 1.71
  
• d1tjhh2 appears in SCOP 1.73
  
• d1tjhh2 appears in SCOPe 2.01
  
• d1tjhh2 appears in the current release, SCOPe 2.08