SCOPe 2.05: Domain d1tjhh1: 1tjh H:1-113

Lineage for d1tjhh1 (1tjh H:1-113)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (68 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d1tjhh1: 1tjh H:1-113 [112450]
   Other proteins in same PDB: d1tjhh2, d1tjhl1, d1tjhl2
   complexed with edo, ipa

Details for d1tjhh1

PDB Entry: 1tjh, 2.1 Å

PDB Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 11mer epitope

PDB Compounds: (H:) anti-HIV-1 antibody 2F5 Heavy Chain

SCOPe Domain Sequences for d1tjhh1:

Sequence; same for both SEQRES and ATOM records:

>d1tjhh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
vwgqgitvtiss

Timeline for d1tjhh1:

• d1tjhh1 first appeared in SCOP 1.71
  
• d1tjhh1 appears in SCOPe 2.04
  
• d1tjhh1 appears in SCOPe 2.06
  
• d1tjhh1 appears in the current release, SCOPe 2.08