Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1tjgh2: 1tjg H:114-216 [112447] Other proteins in same PDB: d1tjgh1, d1tjgl1, d1tjgl2 complexed with egl, ioh, ycm |
PDB Entry: 1tjg (more details), 2 Å
SCOP Domain Sequences for d1tjgh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjgh2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} tstkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1tjgh2: