SCOP 1.71: Domain d1tjgh2: 1tjg H:114-216

Lineage for d1tjgh2 (1tjg H:114-216)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1tjgh2: 1tjg H:114-216 [112447]
   Other proteins in same PDB: d1tjgh1, d1tjgl1, d1tjgl2
   complexed with egl, ioh, ycm

Details for d1tjgh2

PDB Entry: 1tjg, 2 Å

PDB Description: Crystal Structure of the broadly neutralizing anti-HIV-1 antibody 2F5 in complex with a gp41 7mer epitope

SCOP Domain Sequences for d1tjgh2:

Sequence; same for both SEQRES and ATOM records:

>d1tjgh2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tstkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1tjgh2:

• d1tjgh2 is new in SCOP 1.71
  
• d1tjgh2 appears in SCOP 1.73
  
• d1tjgh2 appears in the current release, SCOPe 2.08