![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) ![]() putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2) |
![]() | Family d.67.1.1: Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55187] (1 protein) |
![]() | Protein Threonyl-tRNA synthetase (ThrRS), second 'additional' domain [55188] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55189] (5 PDB entries) Uniprot P0A8M3 |
![]() | Domain d1tjea2: 1tje A:63-224 [112445] Other proteins in same PDB: d1tjea1 |
PDB Entry: 1tje (more details), 1.5 Å
SCOPe Domain Sequences for d1tjea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjea2 d.67.1.1 (A:63-224) Threonyl-tRNA synthetase (ThrRS), second 'additional' domain {Escherichia coli [TaxId: 562]} kdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedvealek rmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvdmc rgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawa
Timeline for d1tjea2: