SCOP 1.71: Domain d1tjcb_: 1tjc B:

Lineage for d1tjcb_ (1tjc B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (2 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (13 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 [117007] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117008] (1 PDB entry)

8. Domain d1tjcb_: 1tjc B: [112441]
   mutant

Details for d1tjcb_

PDB Entry: 1tjc, 2.3 Å

PDB Description: crystal structure of peptide-substrate-binding domain of human type i collagen prolyl 4-hydroxylase

SCOP Domain Sequences for d1tjcb_:

Sequence; same for both SEQRES and ATOM records:

>d1tjcb_ a.118.8.1 (B:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens)}
mfltaedsfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqg
dldkallltkklleldpehqrangnlkyfeyimak

Timeline for d1tjcb_:

• d1tjcb_ is new in SCOP 1.71
  
• d1tjcb_ appears in SCOP 1.73
  
• d1tjcb_ appears in the current release, SCOPe 2.08