![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 [117007] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117008] (1 PDB entry) Uniprot P13674 161-254 |
![]() | Domain d1tjcb_: 1tjc B: [112441] applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1tjc (more details), 2.3 Å
SCOPe Domain Sequences for d1tjcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjcb_ a.118.8.1 (B:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} mfltaedsfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqg dldkallltkklleldpehqrangnlkyfeyimak
Timeline for d1tjcb_: