SCOPe 2.08: Domain d1tjca_: 1tjc A:

Lineage for d1tjca_ (1tjc A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 [117007] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117008] (1 PDB entry)
   Uniprot P13674 161-254

8. Domain d1tjca_: 1tjc A: [112440]
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1tjca_

PDB Entry: 1tjc, 2.3 Å

PDB Description: crystal structure of peptide-substrate-binding domain of human type i collagen prolyl 4-hydroxylase

PDB Compounds: (A:) Prolyl 4-hydroxylase alpha-1 subunit

SCOPe Domain Sequences for d1tjca_:

Sequence; same for both SEQRES and ATOM records:

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}
mfltaedsfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqg
dldkallltkklleldpehqrangnlkyfeyimak

Timeline for d1tjca_:

• d1tjca_ first appeared in SCOP 1.71
  
• d1tjca_ appears in SCOPe 2.07