Lineage for d1tj7b_ (1tj7 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010279Protein Argininosuccinate lyase/delta-crystallin [48564] (4 species)
  7. 2010316Species Escherichia coli [TaxId:562] [117027] (1 PDB entry)
    Uniprot P11447
  8. 2010318Domain d1tj7b_: 1tj7 B: [112439]
    complexed with gol, po4

Details for d1tj7b_

PDB Entry: 1tj7 (more details), 2.44 Å

PDB Description: Structure determination and refinement at 2.44 A resolution of Argininosuccinate lyase from E. coli
PDB Compounds: (B:) Argininosuccinate Lyase

SCOPe Domain Sequences for d1tj7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tj7b_ a.127.1.1 (B:) Argininosuccinate lyase/delta-crystallin {Escherichia coli [TaxId: 562]}
rftqaadqrfkqfndslrfdyrlaeqdivgsvawskalvtvgvltaeeqaqleealnvll
edvrarpqqilesdaedihswvegklidkvgqlgkklhtgrsrndqvatdlklwckdtvs
elltanrqlqsalvetaqnnqdavmpgythlqraqpvtfahwclayvemlardesrlqda
lkrldvsplgcgalagtayeidreqlagwlgfasatrnsldsvsdrdhvlellsaaaigm
vhlsrfaedliffntgeagfvelsdrvtsgsslmpqkknpdalelirgkcgrvqgaltgm
mmtlkglplaynkdmqedkeglfdaldtwldclhmaalvldgiqvkrprcqeaaqqgyan
ateladylvakgvpfreahhivgeavveairqgkpledlplselqkfsqvidedvypils
lqscldkraakggvspqqvaqaiafaqarlg

SCOPe Domain Coordinates for d1tj7b_:

Click to download the PDB-style file with coordinates for d1tj7b_.
(The format of our PDB-style files is described here.)

Timeline for d1tj7b_: