Lineage for d1tj7a_ (1tj7 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543916Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 543917Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 543918Family a.127.1.1: L-aspartase/fumarase [48558] (5 proteins)
  6. 543940Protein Argininosuccinate lyase/delta-crystallin [48564] (4 species)
  7. 543977Species Escherichia coli [TaxId:562] [117027] (1 PDB entry)
  8. 543978Domain d1tj7a_: 1tj7 A: [112438]

Details for d1tj7a_

PDB Entry: 1tj7 (more details), 2.44 Å

PDB Description: structure determination and refinement at 2.44 a resolution of argininosuccinate lyase from e. coli

SCOP Domain Sequences for d1tj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tj7a_ a.127.1.1 (A:) Argininosuccinate lyase/delta-crystallin {Escherichia coli}
lwggrftqaadqrfkqfndslrfdyrlaeqdivgsvawskalvtvgvltaeeqaqleeal
nvlledvrarpqqilesdaedihswvegklidkvgqlgkklhtgrsrndqvatdlklwck
dtvselltanrqlqsalvetaqnnqdavmpgythlqraqpvtfahwclayvemlardesr
lqdalkrldvsplgcgalagtayeidreqlagwlgfasatrnsldsvsdrdhvlellsaa
aigmvhlsrfaedliffntgeagfvelsdrvtsgsslmpqkknpdalelirgkcgrvqga
ltgmmmtlkglplaynkdmqedkeglfdaldtwldclhmaalvldgiqvkrprcqeaaqq
gyanateladylvakgvpfreahhivgeavveairqgkpledlplselqkfsqvidedvy
pilslqscldkraakggvspqqvaqaiafaqarlg

SCOP Domain Coordinates for d1tj7a_:

Click to download the PDB-style file with coordinates for d1tj7a_.
(The format of our PDB-style files is described here.)

Timeline for d1tj7a_: