Lineage for d1tj2a1 (1tj2 A:89-261)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779749Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
    multihelical; array
  4. 779750Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (1 family) (S)
  5. 779751Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein)
  6. 779752Protein N-terminal domain of bifunctional PutA protein [81937] (1 species)
    includes the N-terminal swapping arm made of three helices; possible DNA-binding function
  7. 779753Species Escherichia coli [TaxId:562] [81938] (7 PDB entries)
    Uniprot P09546 87-610
  8. 779755Domain d1tj2a1: 1tj2 A:89-261 [112436]
    Other proteins in same PDB: d1tj2a2
    complexed with act, fad

Details for d1tj2a1

PDB Entry: 1tj2 (more details), 2.05 Å

PDB Description: Crystal structure of E. coli PutA proline dehydrogenase domain (residues 86-669) complexed with acetate
PDB Compounds: (A:) Bifunctional putA protein

SCOP Domain Sequences for d1tj2a1:

Sequence, based on SEQRES records: (download)

>d1tj2a1 a.176.1.1 (A:89-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
svsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragmv
qgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvna
atwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records): (download)

>d1tj2a1 a.176.1.1 (A:89-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
svsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragmg
valmclaeallripdkatrdalirkgvdmamrlmgeqfvt

SCOP Domain Coordinates for d1tj2a1:

Click to download the PDB-style file with coordinates for d1tj2a1.
(The format of our PDB-style files is described here.)

Timeline for d1tj2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tj2a2