Class a: All alpha proteins [46456] (284 folds) |
Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily) multihelical; array |
Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (1 family) |
Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein) |
Protein N-terminal domain of bifunctional PutA protein [81937] (1 species) includes the N-terminal swapping arm made of three helices; possible DNA-binding function |
Species Escherichia coli [TaxId:562] [81938] (7 PDB entries) Uniprot P09546 87-610 |
Domain d1tj0a1: 1tj0 A:89-261 [112432] Other proteins in same PDB: d1tj0a2 complexed with fad, lac |
PDB Entry: 1tj0 (more details), 2.1 Å
SCOP Domain Sequences for d1tj0a1:
Sequence, based on SEQRES records: (download)
>d1tj0a1 a.176.1.1 (A:89-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]} svsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragmv qgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvna atwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt
>d1tj0a1 a.176.1.1 (A:89-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]} svsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragmv qgllqefslssqegvalmclaeallripdkatrdalirdplirkgvdmamrlmgeqfvt
Timeline for d1tj0a1: