SCOPe 2.01: Domain d1tiwa1: 1tiw A:89-261

Lineage for d1tiwa1 (1tiw A:89-261)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
   multihelical; array

4. Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (1 family)

5. Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein)

6. Protein N-terminal domain of bifunctional PutA protein [81937] (1 species)
   includes the N-terminal swapping arm made of three helices; possible DNA-binding function

7. Species Escherichia coli [TaxId:562] [81938] (7 PDB entries)
   Uniprot P09546 87-610

8. Domain d1tiwa1: 1tiw A:89-261 [112430]
   Other proteins in same PDB: d1tiwa2
   complexed with fad, tfb

Details for d1tiwa1

PDB Entry: 1tiw, 2 Å

PDB Description: Crystal structure of E. coli PutA proline dehydrogenase domain (residues 86-669) complexed with L-Tetrahydro-2-furoic acid

PDB Compounds: (A:) Bifunctional putA protein

SCOPe Domain Sequences for d1tiwa1:

Sequence, based on SEQRES records:

>d1tiwa1 a.176.1.1 (A:89-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
svsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragmv
qgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvna
atwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records):

>d1tiwa1 a.176.1.1 (A:89-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
svsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragmg
valmclaeallripdkatrdalirdsgeplirkgvdmamrlmgeqfvt

Timeline for d1tiwa1:

• d1tiwa1 first appeared in SCOP 1.71
  
• d1tiwa1 appears in SCOP 1.75
  
• d1tiwa1 appears in SCOPe 2.02
  
• d1tiwa1 appears in the current release, SCOPe 2.08