![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily) multihelical; array |
![]() | Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (1 family) ![]() |
![]() | Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein) |
![]() | Protein N-terminal domain of bifunctional PutA protein [81937] (1 species) includes the N-terminal swapping arm made of three helices; possible DNA-binding function |
![]() | Species Escherichia coli [TaxId:562] [81938] (5 PDB entries) |
![]() | Domain d1tiwa1: 1tiw A:89-261 [112430] Other proteins in same PDB: d1tiwa2 complexed with fad, tfb |
PDB Entry: 1tiw (more details), 2 Å
SCOP Domain Sequences for d1tiwa1:
Sequence, based on SEQRES records: (download)
>d1tiwa1 a.176.1.1 (A:89-261) N-terminal domain of bifunctional PutA protein {Escherichia coli} svsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragmv qgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvna atwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt
>d1tiwa1 a.176.1.1 (A:89-261) N-terminal domain of bifunctional PutA protein {Escherichia coli} svsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragmg valmclaeallripdkatrdalirdsgeplirkgvdmamrlmgeqfvt
Timeline for d1tiwa1: