Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein Thioredoxin [52835] (16 species) |
Species European aspen (Populus tremula), thioredoxin H [TaxId:113636] [117590] (1 PDB entry) Uniprot Q8S3L3 |
Domain d1ti3a_: 1ti3 A: [112429] |
PDB Entry: 1ti3 (more details)
SCOPe Domain Sequences for d1ti3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} aeegqviachtvdtwkehfekgkgsqklivvdftaswcppckmiapifaelakkfpnvtf lkvdvdelkavaeewnveamptfiflkdgklvdktvgadkdglptlvakhata
Timeline for d1ti3a_: