Lineage for d1ti3a_ (1ti3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876321Species European aspen (Populus tremula), thioredoxin H [TaxId:113636] [117590] (1 PDB entry)
    Uniprot Q8S3L3
  8. 2876322Domain d1ti3a_: 1ti3 A: [112429]

Details for d1ti3a_

PDB Entry: 1ti3 (more details)

PDB Description: solution structure of the thioredoxin h1 from poplar, a cppc active site variant
PDB Compounds: (A:) thioredoxin H

SCOPe Domain Sequences for d1ti3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]}
aeegqviachtvdtwkehfekgkgsqklivvdftaswcppckmiapifaelakkfpnvtf
lkvdvdelkavaeewnveamptfiflkdgklvdktvgadkdglptlvakhata

SCOPe Domain Coordinates for d1ti3a_:

Click to download the PDB-style file with coordinates for d1ti3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ti3a_: