Lineage for d1tgra_ (1tgr A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634416Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2634417Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2634418Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2634641Protein Insulin-like growth factor [57002] (1 species)
  7. 2634642Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
    Uniprot P05019 49-110
  8. 2634667Domain d1tgra_: 1tgr A: [112427]
    mini-IGF-IB deletion mutant

Details for d1tgra_

PDB Entry: 1tgr (more details), 1.42 Å

PDB Description: crystal structure of mini-igf-1(2)
PDB Compounds: (A:) insulin-like growth factor ia

SCOPe Domain Sequences for d1tgra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgra_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
gpetlcgaelvdalqfvcgdrgfyfnkpkakgivdeccfrscdlrrlemyca

SCOPe Domain Coordinates for d1tgra_:

Click to download the PDB-style file with coordinates for d1tgra_.
(The format of our PDB-style files is described here.)

Timeline for d1tgra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tgrb_