SCOPe 2.01: Domain d1tgra_: 1tgr A:

Lineage for d1tgra_ (1tgr A:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (19 PDB entries)
   Uniprot P05019 49-110

8. Domain d1tgra_: 1tgr A: [112427]
   mini-IGF-IB deletion mutant

Details for d1tgra_

PDB Entry: 1tgr, 1.42 Å

PDB Description: crystal structure of mini-igf-1(2)

PDB Compounds: (A:) insulin-like growth factor ia

SCOPe Domain Sequences for d1tgra_:

Sequence; same for both SEQRES and ATOM records:

>d1tgra_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
gpetlcgaelvdalqfvcgdrgfyfnkpkakgivdeccfrscdlrrlemyca

Timeline for d1tgra_:

• d1tgra_ first appeared in SCOP 1.71
  
• d1tgra_ appears in SCOP 1.75
  
• d1tgra_ appears in SCOPe 2.02
  
• d1tgra_ appears in the current release, SCOPe 2.08