Lineage for d1tgqa_ (1tgq A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609436Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 609662Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 609663Family d.110.7.1: Roadblock/LC7 domain [103197] (4 proteins)
    Pfam 03259
  6. 609664Protein Dynein light chain 2A, cytoplasmic [118074] (1 species)
  7. 609665Species Human (Homo sapiens) [TaxId:9606] [118075] (1 PDB entry)
  8. 609666Domain d1tgqa_: 1tgq A: [112426]
    Structural genomics target

Details for d1tgqa_

PDB Entry: 1tgq (more details)

PDB Description: Solution NMR Structure of Protein Dynein Light Chain 2A, Cytoplasmic; Northeast Structural Genomics Consortium Target HR2106

SCOP Domain Sequences for d1tgqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgqa_ d.110.7.1 (A:) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens)}
maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
dpqndltflrirskkneimvapdkdyfliviqnpte

SCOP Domain Coordinates for d1tgqa_:

Click to download the PDB-style file with coordinates for d1tgqa_.
(The format of our PDB-style files is described here.)

Timeline for d1tgqa_: