![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.5: Beta-galactosidase LacA, domain 2 [117301] (1 protein) contains extra C-terminal beta-sandwich subdomain [greek-key; partial topological similarity to the immunoglobulin-like fold] automatically mapped to Pfam PF10435 |
![]() | Protein Beta-galactosidase LacA, domain 2 [117302] (1 species) |
![]() | Species Penicillium sp. [TaxId:5081] [117303] (2 PDB entries) Uniprot Q700S9 41-1011 |
![]() | Domain d1tg7a4: 1tg7 A:395-569 [112421] Other proteins in same PDB: d1tg7a1, d1tg7a2, d1tg7a3, d1tg7a5 complexed with edo, na, nag, po4 |
PDB Entry: 1tg7 (more details), 1.9 Å
SCOPe Domain Sequences for d1tg7a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tg7a4 b.71.1.5 (A:395-569) Beta-galactosidase LacA, domain 2 {Penicillium sp. [TaxId: 5081]} gylvanpgdlststytntadltvtpllgsnssassffvirhsdyssqasveykltvptsa gnltipqlggsltlsgrdskihvtdydvagtnilystaevftwkkfnnekvlvlyggpge hhefavsgassssvvegsssgisskkvgkalvvawdvstarrivqvgslkvflld
Timeline for d1tg7a4:
![]() Domains from same chain: (mouse over for more information) d1tg7a1, d1tg7a2, d1tg7a3, d1tg7a5 |