Lineage for d1tg7a3 (1tg7 A:849-1011)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792799Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 792800Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) (S)
  5. 793304Family b.18.1.27: Beta-galactosidase LacA, domains 4 and 5 [117111] (1 protein)
    duplication: tandem repeat of two similar domains; some sequence similarity to the beta-Galactosidase/glucuronidase N-terminal domain ((49803))
    duplication: tandem repeat of two similar domains; some sequence similarity to the beta-Galactosidase/glucuronidase N-terminal domain ((49803))
  6. 793305Protein Beta-galactosidase LacA, domains 4 and 5 [117112] (1 species)
  7. 793306Species Penicillium sp. [TaxId:5081] [117113] (2 PDB entries)
    Uniprot Q700S9 41-1011
  8. 793308Domain d1tg7a3: 1tg7 A:849-1011 [112420]
    Other proteins in same PDB: d1tg7a1, d1tg7a4, d1tg7a5
    complexed with edo, man, na, nag, po4

Details for d1tg7a3

PDB Entry: 1tg7 (more details), 1.9 Å

PDB Description: native structure of beta-galactosidase from penicillium sp.
PDB Compounds: (A:) beta-galactosidase

SCOP Domain Sequences for d1tg7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tg7a3 b.18.1.27 (A:849-1011) Beta-galactosidase LacA, domains 4 and 5 {Penicillium sp. [TaxId: 5081]}
rdtvrgplnegglyaerqgfhqpqpptqkwdssspftgltkpgirfystsfdldlpsgyd
iplyfnfgnststpaayrvqlyvngyqygkyvnnigpqtsfpvpegilnyhgtnwlalsl
waqedngakldsfelinttpvltslgevksvnqpkyqarkgay

SCOP Domain Coordinates for d1tg7a3:

Click to download the PDB-style file with coordinates for d1tg7a3.
(The format of our PDB-style files is described here.)

Timeline for d1tg7a3: