| Class b: All beta proteins [48724] (176 folds) |
| Fold b.149: Beta-galactosidase LacA, domain 3 [117099] (1 superfamily) sandwich; 8 strands in 2 sheets |
Superfamily b.149.1: Beta-galactosidase LacA, domain 3 [117100] (2 families) ![]() automatically mapped to Pfam PF13363 |
| Family b.149.1.1: Beta-galactosidase LacA, domain 3 [117101] (1 protein) |
| Protein Beta-galactosidase LacA, domain 3 [117102] (1 species) |
| Species Penicillium sp. [TaxId:5081] [117103] (2 PDB entries) Uniprot Q700S9 41-1011 |
| Domain d1tg7a1: 1tg7 A:570-666 [112418] Other proteins in same PDB: d1tg7a2, d1tg7a3, d1tg7a4, d1tg7a5 complexed with edo, na, nag, po4 |
PDB Entry: 1tg7 (more details), 1.9 Å
SCOPe Domain Sequences for d1tg7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tg7a1 b.149.1.1 (A:570-666) Beta-galactosidase LacA, domain 3 {Penicillium sp. [TaxId: 5081]}
rnsaynywvpqvptkgtapgysnqettassiivkagylvrsayldgndlhiqadfnattp
ievvgapsgaknlvingkktqtkvdkngiwsasvayt
Timeline for d1tg7a1:
View in 3DDomains from same chain: (mouse over for more information) d1tg7a2, d1tg7a3, d1tg7a4, d1tg7a5 |