Lineage for d1tg7a1 (1tg7 A:570-666)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680873Fold b.149: Beta-galactosidase LacA, domain 3 [117099] (1 superfamily)
    sandwich; 8 strands in 2 sheets
  4. 680874Superfamily b.149.1: Beta-galactosidase LacA, domain 3 [117100] (1 family) (S)
  5. 680875Family b.149.1.1: Beta-galactosidase LacA, domain 3 [117101] (1 protein)
  6. 680876Protein Beta-galactosidase LacA, domain 3 [117102] (1 species)
  7. 680877Species Penicillium sp. [TaxId:5081] [117103] (2 PDB entries)
  8. 680878Domain d1tg7a1: 1tg7 A:570-666 [112418]
    Other proteins in same PDB: d1tg7a2, d1tg7a3, d1tg7a4, d1tg7a5
    complexed with edo, man, na, nag, po4

Details for d1tg7a1

PDB Entry: 1tg7 (more details), 1.9 Å

PDB Description: native structure of beta-galactosidase from penicillium sp.
PDB Compounds: (A:) beta-galactosidase

SCOP Domain Sequences for d1tg7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tg7a1 b.149.1.1 (A:570-666) Beta-galactosidase LacA, domain 3 {Penicillium sp. [TaxId: 5081]}
rnsaynywvpqvptkgtapgysnqettassiivkagylvrsayldgndlhiqadfnattp
ievvgapsgaknlvingkktqtkvdkngiwsasvayt

SCOP Domain Coordinates for d1tg7a1:

Click to download the PDB-style file with coordinates for d1tg7a1.
(The format of our PDB-style files is described here.)

Timeline for d1tg7a1: