Lineage for d1tg2a_ (1tg2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004816Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 3004817Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 3004818Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins)
  6. 3004819Protein Phenylalanine hydroxylase, PAH [56538] (3 species)
  7. 3004834Species Human (Homo sapiens) [TaxId:9606] [56539] (16 PDB entries)
    Uniprot P00439 117-424
  8. 3004846Domain d1tg2a_: 1tg2 A: [112417]
    complexed with fe, h2b; mutant

Details for d1tg2a_

PDB Entry: 1tg2 (more details), 2.2 Å

PDB Description: crystal structure of phenylalanine hydroxylase a313t mutant with 7,8- dihydrobiopterin bound
PDB Compounds: (A:) phenylalanine-4-hydroxylase

SCOPe Domain Sequences for d1tg2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tg2a_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens) [TaxId: 9606]}
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgtpdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievl

SCOPe Domain Coordinates for d1tg2a_:

Click to download the PDB-style file with coordinates for d1tg2a_.
(The format of our PDB-style files is described here.)

Timeline for d1tg2a_: