SCOP 1.71: Domain d1tezc1: 1tez C:205-475

Lineage for d1tezc1 (1tez C:205-475)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
   multihelical; consists of two all-alpha subdomains

4. Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family)

5. Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)

6. Protein C-terminal domain of DNA photolyase [48175] (3 species)
   N-terminal domain is alpha/beta and binds a light-harvesting cofactor

7. Species Anacystis nidulans [48177] (7 PDB entries)

8. Domain d1tezc1: 1tez C:205-475 [112413]
   Other proteins in same PDB: d1teza2, d1tezb2, d1tezc2, d1tezd2

Details for d1tezc1

PDB Entry: 1tez, 1.8 Å

PDB Description: complex between dna and the dna photolyase from anacystis nidulans

SCOP Domain Sequences for d1tezc1:

Sequence; same for both SEQRES and ATOM records:

>d1tezc1 a.99.1.1 (C:205-475) C-terminal domain of DNA photolyase {Anacystis nidulans}
pvepgetaaiarlqefcdraiadydpqrnfpaeagtsglspalkfgaigirqawqaasaa
halsrsdearnsirvwqqelawrefyqhalyhfpsladgpyrslwqqfpwenrealftaw
tqaqtgypivdaamrqltetgwmhnrcrmivasfltkdliidwrrgeqffmqhlvdgdla
annggwqwsassgmdpkplrifnpasqakkfdatatyikrwlpelrhvhpkdlisgeitp
ierrgypapivnhnlrqkqfkalynqlkaai

Timeline for d1tezc1:

• d1tezc1 is new in SCOP 1.71
  
• d1tezc1 appears in SCOP 1.73
  
• d1tezc1 appears in the current release, SCOPe 2.08